PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005815P3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 572aa    MW: 63996.3 Da    PI: 5.0127
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005815P3genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix39.91.1e-122454287
        trihelix 42 gferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
                    g++r++k+Ckek+en++k+yk++keg+++r  ++ +t+++f+qlea
  MELO3C005815P3  2 GYKRNAKKCKEKFENVQKYYKRTKEGRGGR--QDGKTYKFFTQLEA 45
                    9***************************98..56667*******85 PP

2trihelix105.92.7e-33355440187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+kqevlaLi++r  +e++++++  k+plWee+s+ m + g++rs+k+Ckekwen+nk++kk+ke++kkr  e+s+tcpyf++l+a
  MELO3C005815P3 355 RWPKQEVLALIKLRGGLESKYQETGPKGPLWEEISAGMIKMGYKRSAKRCKEKWENINKYFKKVKESNKKR-REDSKTCPYFNELDA 440
                     8*********************************************************************8.78999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.1E-7246No hitNo description
PROSITE profilePS500906.922348412IPR017877Myb-like domain
PfamPF138375.9E-23354441No hitNo description
CDDcd122031.61E-30354419No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MGYKRNAKKC KEKFENVQKY YKRTKEGRGG RQDGKTYKFF TQLEALHNAN VAPSSSNSSF  60
TLPQPLPAAA TTTTPVGFGI SNPTPISSVK ISSSSSQTPM GIFSTPSDHF TVRPPPAVAA  120
PMGVSFSSNT SSASTEDDDD DDEDEEMGFD VDLEGEPENV AGSSRKRRRG VVKGNNDEWR  180
SSSSSSDHKM MMEFFEGLMK QVMEKQEVMQ QKFLEAIEKR EQDRMVREEN WKKEEMFRLS  240
QEQERMAQER TISASRDAAI IAFLQKFTGQ TIQFSAPATA PQVPVPVPMA VSVPMPMPVP  300
APLSPVSSHQ PMQPQTLPHL QIQPPTNTIP LEQPKPKLQE IIQGGDGSSE PISSRWPKQE  360
VLALIKLRGG LESKYQETGP KGPLWEEISA GMIKMGYKRS AKRCKEKWEN INKYFKKVKE  420
SNKKRREDSK TCPYFNELDA LYRKKILSTA AATATASDHS GSFEQNPIQN MEIIPPSTTT  480
TTTDHHLQSQ PHSSSIPQGL SATLFGEGTE EQQQQPTSTK PEDIVNELME LQEDDIYRRH  540
LNQDDGNDEN NDDYCSDDDE DDEDDLPEEK K*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311KRNAKKCKE
2164168RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437492.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
TrEMBLG8G9Q91e-144G8G9Q9_POPCN; GTL1
STRINGPOPTR_0001s45870.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-62Trihelix family protein